PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0116s0038.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 412aa    MW: 46904 Da    PI: 10.2107
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0116s0038.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.48.1e-161098197
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92
                         ffkv t+ ++++  r+ +p++f++ + g  +++    l  +sg++W v+l   + +++ ++t+GW+ Fvk+n ++ gDf+ Fkl+ +  f  
  Kalax.0116s0038.1.p 10 FFKVYTTDHSFN--RMKVPREFVAYMRGR-TCG-AAELAGRSGETWLVEL--VQEGKHLFFTDGWQTFVKENMVEYGDFLFFKLHCNLMF-- 93
                         889997777775..58*******555555.565.89**************..999999*************************9775433.. PP

                         EEEEE CS
                   B3 93 vvkvf 97
                          v +f
  Kalax.0116s0038.1.p 94 SVVIF 98
                         56665 PP

2B359.84.7e-19178263897
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          s+ +  + l++p++f++e+++k e++ +++l+++++ sWev++   +++g++ l +GW  F+++n+L++gD++ F+l++  + e+ v+v 
  Kalax.0116s0038.1.p 178 SNLGLGNYLRFPRSFIRENSLKYESNEKMVLRTSNNSSWEVNI--INNGGAISLCRGWAAFARDNNLRVGDVCKFELVD--RLEMAVHVS 263
                          444555889**********99999999****************..99999**************************987..455567665 PP

3B353.73.7e-17315406196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+  +++ +v +  ++ +p  f++e++    + ++++l++    sW+v+l   +++ +y + +GW +Fv++n++kegD++ F+l +  + 
  Kalax.0116s0038.1.p 315 FVACMKTYHVKRPFIMNIPTWFVRENSVRYGRRQKMVLRTNGDSSWSVTL--LRNQHKYCFCGGWADFVRDNNIKEGDSCKFELLN--RL 400
                          66778888999999************666667789***************..999999*************************876..45 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v++
  Kalax.0116s0038.1.p 401 EMKVHL 406
                          556665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-196102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-206103IPR015300DNA-binding pseudobarrel domain
CDDcd100171.69E-14899No hitNo description
PROSITE profilePS5086313.1128101IPR003340B3 DNA binding domain
SMARTSM010196.7E-1110101IPR003340B3 DNA binding domain
PfamPF023621.3E-131099IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.3E-21169264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-20170263IPR015300DNA-binding pseudobarrel domain
CDDcd100171.44E-16170262No hitNo description
PROSITE profilePS5086314.001171266IPR003340B3 DNA binding domain
SMARTSM010191.2E-13171268IPR003340B3 DNA binding domain
PfamPF023621.5E-16178262IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-22309407IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-21312408IPR015300DNA-binding pseudobarrel domain
CDDcd100175.80E-17313406No hitNo description
PROSITE profilePS5086313.126315410IPR003340B3 DNA binding domain
SMARTSM010196.5E-15315410IPR003340B3 DNA binding domain
PfamPF023621.3E-14315407IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDEADNLPEF FKVYTTDHSF NRMKVPREFV AYMRGRTCGA AELAGRSGET WLVELVQEGK  60
HLFFTDGWQT FVKENMVEYG DFLFFKLHCN LMFSVVIFDG TMCEKGVALG AKCSRGRDGV  120
LGAEEVQNGA KPVKRNRVRC SLPEGVRSDL SIPDPKDRAA ELISISVKAS FVQHIKISNL  180
GLGNYLRFPR SFIRENSLKY ESNEKMVLRT SNNSSWEVNI INNGGAISLC RGWAAFARDN  240
NLRVGDVCKF ELVDRLEMAV HVSQRHVEIR PEKVNAARSK LRPLTRAVGA SQPVLRRVGQ  300
KEAARSRPSS VKPSFVACMK TYHVKRPFIM NIPTWFVREN SVRYGRRQKM VLRTNGDSSW  360
SVTLLRNQHK YCFCGGWADF VRDNNIKEGD SCKFELLNRL EMKVHLMPRS K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-20B3 family protein